PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G217200.1.p
Common NameSb05g026820, SORBIDRAFT_05g026820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 366aa    MW: 39634 Da    PI: 6.5043
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G217200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-1770117148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg+WT +Ed+ l+++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Sobic.005G217200.1.p  70 RGPWTVDEDLTLINYIADHGEGRWNALARAAGLKRTGKSCRLRWLNYL 117
                           89********************************************97 PP

2Myb_DNA-binding52.98.2e-17123166146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg +T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  Sobic.005G217200.1.p 123 RGDFTADEQLLILDLHSRWGNR-WSKIAAHLP-GRTDNEIKNYWRT 166
                           899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5665117IPR017930Myb domain
SuperFamilySSF466895.99E-3068164IPR009057Homeodomain-like
SMARTSM007176.3E-1569119IPR001005SANT/Myb domain
PfamPF002499.2E-1670117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-2271124IPR009057Homeodomain-like
CDDcd001671.78E-1172117No hitNo description
PROSITE profilePS5129423.521118172IPR017930Myb domain
SMARTSM007173.0E-15122170IPR001005SANT/Myb domain
PfamPF002492.1E-15123166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-24125171IPR009057Homeodomain-like
CDDcd001671.30E-11126166No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MMEMVLQQSQ SAGGGAGMFP GVAAAACRRG PSRPAATAPM MAKQEQVVAD EQDQQQAAGE  60
EEGAGDELRR GPWTVDEDLT LINYIADHGE GRWNALARAA GLKRTGKSCR LRWLNYLRPD  120
VKRGDFTADE QLLILDLHSR WGNRWSKIAA HLPGRTDNEI KNYWRTRVQK HAKQLNCDVN  180
SKRFKDAMRF LWMPRLAERA TAAAHHHPPS PSLTTCVLGG GMAASSSSSA LMKMLDDATV  240
SNRSSCSPSS AVTCSSSSCS SLTSVDTAHD DGGARPHAAS AAVAFTAADD DDYWGAATAT  300
TTTMQQQQQQ NDQHYDFWST ASALQHLCTA ADHDITGWVQ GFSDGGILSG SSSFWSLDDI  360
WRMPQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-26451642120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7284140.0KJ728414.1 Zea mays clone pUT6719 MYB transcription factor (MYB4) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451276.10.0hypothetical protein SORBIDRAFT_05g026820
TrEMBLC5Y8060.0C5Y806_SORBI; Putative uncharacterized protein Sb05g026820
STRINGSb05g026820.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.15e-76myb domain protein 112